PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G004957_P01
Common NameHDZIV7_OCL7, ZEAMMB73_439037, Zm.2616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 769aa    MW: 83011.8 Da    PI: 6.3214
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G004957_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.2e-2080135156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe++F++ ++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  GRMZM2G004957_P01  80 KKRYHRHTQHQIQELEAFFKEYPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 135
                        688999***********************************************999 PP

2START189.91.3e-592715001206
                        HHHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
              START   1 elaeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                        ela +a++elv++al++ep+W           e +n++e+ + f + +v       ++ea+r+ +vv+m+++ l e l+d++ qW++ +   
  GRMZM2G004957_P01 271 ELAVAAMEELVRMALLGEPLWIPALavdgattETLNEEEYARGFFPRGVgpklpeLRSEASREAVVVIMNHVSLIEMLMDVN-QWSTLFSsi 361
                        57899*****************99999*****************99999*********************************.******999 PP

                        ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECT CS
              START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksn 159
                          +a+tlev+s+g      galqlm+ae+q++splvp R+  f+Ry++q+++g+w++vdvSv+ +  ++   ++  R++++pSg+li++++n
  GRMZM2G004957_P01 362 vsRAATLEVLSTGvagnynGALQLMTAEFQMPSPLVPtRECQFLRYCKQHTDGSWAVVDVSVEGQLLRTGsRQGRGRGRRRPSGCLIQEMPN 453
                        99*************************************************************999999989999***************** PP

                        CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        g+s+vtwveh++ ++ ++h l+r+lv sgla+ga++w +tl+rqce+
  GRMZM2G004957_P01 454 GYSRVTWVEHAEADDMMVHDLYRPLVCSGLAFGARRWASTLERQCER 500
                        *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-2166120IPR009057Homeodomain-like
SuperFamilySSF466893.59E-1972138IPR009057Homeodomain-like
PROSITE profilePS5007117.21677137IPR001356Homeobox domain
SMARTSM003897.7E-1978141IPR001356Homeobox domain
CDDcd000867.06E-1979138No hitNo description
PfamPF000461.2E-1780135IPR001356Homeobox domain
PROSITE patternPS000270112135IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.602.6E-4121165IPR009057Homeodomain-like
PROSITE profilePS5084842.54262503IPR002913START domain
SuperFamilySSF559612.2E-32263502No hitNo description
CDDcd088751.89E-105266499No hitNo description
SMARTSM002342.1E-54271500IPR002913START domain
PfamPF018521.2E-49272500IPR002913START domain
Gene3DG3DSA:3.30.530.203.5E-7346464IPR023393START-like domain
SuperFamilySSF559617.94E-23526749No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    Send to blast
MLQNMMDGHH QLAMMQQQHQ NHGQQQAATS ESDARGPRHD ELLMESKSGS DNMEGGARSG  60
GSGGEELQEE DLGLRQPARK KRYHRHTQHQ IQELEAFFKE YPHPDDKQRK ELSRELGLEP  120
LQVKFWFQNK RTQMKTQQER HENMQLRAEN EKLRAENARY KDALANASCP SCGGPAATAV  180
IGEMSFDEHH LRVENARLRD EVDRISTIAA KYVGKPAGSL LLLPPNNLSN NVSGPALSSH  240
HHLLPGGTDV FGGLHRHAGG GFDFDKGLVV ELAVAAMEEL VRMALLGEPL WIPALAVDGA  300
TTETLNEEEY ARGFFPRGVG PKLPELRSEA SREAVVVIMN HVSLIEMLMD VNQWSTLFSS  360
IVSRAATLEV LSTGVAGNYN GALQLMTAEF QMPSPLVPTR ECQFLRYCKQ HTDGSWAVVD  420
VSVEGQLLRT GSRQGRGRGR RRPSGCLIQE MPNGYSRVTW VEHAEADDMM VHDLYRPLVC  480
SGLAFGARRW ASTLERQCER LASAMASGVV VPAAAAGPAA GVVTSPEGRR SMMRLAERMV  540
ASFCGGVTAS TTHQWTTLSG SGAEDVRVMT RKSVDDPGRP PGIILNAATS FWLPVAPARV  600
FGFLRDDATR SEWDMLSNGG DVQEMAHIAN GRDHGNAVSL LRVDNANSNQ GNMLILQECC  660
TDATGSYVIY APVDVVAMNV VLNGGDPDYV ALLPSGFAIL PDGGGGGGGG SLLTVAFQIL  720
VDSVPTAKLS LGSVATVNSL IACTVERIKA AVAADNAGVA AAAAATSHH
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G004957
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G004957_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5551430.0AY555143.1 Zea may BAC clone c573L14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008662906.10.0PREDICTED: homeobox-leucine zipper protein ROC7-like isoform X3
SwissprotA2YR020.0ROC7_ORYSI; Homeobox-leucine zipper protein ROC7
TrEMBLG2J5S10.0G2J5S1_MAIZE; Homeodomain leucine zipper family IV protein
STRINGGRMZM2G004957_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Javelle M, et al.
    Genome-wide characterization of the HD-ZIP IV transcription factor family in maize: preferential expression in the epidermis.
    Plant Physiol., 2011. 157(2): p. 790-803
    [PMID:21825105]